Lineage for d1hlpb1 (1hlp B:21-162)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66837Protein Malate dehydrogenase [51849] (7 species)
  7. 66855Species Haloarcula marismortui [TaxId:2238] [51855] (3 PDB entries)
  8. 66861Domain d1hlpb1: 1hlp B:21-162 [30146]
    Other proteins in same PDB: d1hlpa2, d1hlpb2

Details for d1hlpb1

PDB Entry: 1hlp (more details), 3.2 Å

PDB Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium

SCOP Domain Sequences for d1hlpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlpb1 c.2.1.5 (B:21-162) Malate dehydrogenase {Haloarcula marismortui}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvigfg

SCOP Domain Coordinates for d1hlpb1:

Click to download the PDB-style file with coordinates for d1hlpb1.
(The format of our PDB-style files is described here.)

Timeline for d1hlpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlpb2