Lineage for d1d3ab1 (1d3a B:22-162)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66837Protein Malate dehydrogenase [51849] (7 species)
  7. 66855Species Haloarcula marismortui [TaxId:2238] [51855] (3 PDB entries)
  8. 66859Domain d1d3ab1: 1d3a B:22-162 [30144]
    Other proteins in same PDB: d1d3aa2, d1d3ab2

Details for d1d3ab1

PDB Entry: 1d3a (more details), 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form

SCOP Domain Sequences for d1d3ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ab1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

SCOP Domain Coordinates for d1d3ab1:

Click to download the PDB-style file with coordinates for d1d3ab1.
(The format of our PDB-style files is described here.)

Timeline for d1d3ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ab2