Lineage for d1d3ab1 (1d3a B:22-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844801Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)
  8. 2844811Domain d1d3ab1: 1d3a B:22-162 [30144]
    Other proteins in same PDB: d1d3aa2, d1d3ab2
    complexed with cl, na

Details for d1d3ab1

PDB Entry: 1d3a (more details), 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form
PDB Compounds: (B:) halophilic malate dehydrogenase

SCOPe Domain Sequences for d1d3ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ab1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

SCOPe Domain Coordinates for d1d3ab1:

Click to download the PDB-style file with coordinates for d1d3ab1.
(The format of our PDB-style files is described here.)

Timeline for d1d3ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3ab2