![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein Malate dehydrogenase [51849] (13 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries) |
![]() | Domain d1d3aa1: 1d3a A:22-162 [30143] Other proteins in same PDB: d1d3aa2, d1d3ab2 complexed with cl, na |
PDB Entry: 1d3a (more details), 2.94 Å
SCOPe Domain Sequences for d1d3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3aa1 c.2.1.5 (A:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]} tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn pvdllnrhlyeagdrsreqvig
Timeline for d1d3aa1: