Lineage for d4y284_ (4y28 4:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028483Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)
  8. 3028520Domain d4y284_: 4y28 4: [301414]
    Other proteins in same PDB: d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e1, d4y28e2, d4y28f_, d4y28j_, d4y28l_
    automated match to d4y282_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y284_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d4y284_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y284_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kkgewlpglaspgyltgslpgdngfdplglaedpenlrwfvqaelvngrwamlgvagmll
pevftsigiinvpkwydagkeeyfassstlfviefilshyveirrwqdiknpgsvnqdpi
fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd
nllqhisdpwhntivqtl

SCOPe Domain Coordinates for d4y284_:

Click to download the PDB-style file with coordinates for d4y284_.
(The format of our PDB-style files is described here.)

Timeline for d4y284_: