![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (2 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries) |
![]() | Domain d4y283_: 4y28 3: [301413] Other proteins in same PDB: d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e_, d4y28f_, d4y28j_ automated match to d4y282_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y283_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y283_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} wfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgavgai apeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfqdwa kpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrlamla ilgyfiqglvtgvgpyqnlldhvadpvnnnvltsl
Timeline for d4y283_: