SCOPe 2.08: Domain d4xzuf2: 4xzu F:110-212

Lineage for d4xzuf2 (4xzu F:110-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4xzuf2: 4xzu F:110-212 [301388]
   Other proteins in same PDB: d4xzua_, d4xzub1, d4xzue_, d4xzuf1, d4xzug_, d4xzum_
   automated match to d4ebql2
   complexed with mg

Details for d4xzuf2

PDB Entry: 4xzu, 2.61 Å

PDB Description: crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody

PDB Compounds: (F:) 3E6 antibody Fab light chain

SCOPe Domain Sequences for d4xzuf2:

Sequence, based on SEQRES records:

>d4xzuf2 b.1.1.2 (F:110-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathststspivksfnrne

Sequence, based on observed residues (ATOM records):

>d4xzuf2 b.1.1.2 (F:110-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkqngvlnswtdqdskdstysms
stltltkdeyetceathivksfnrne

Timeline for d4xzuf2:

• d4xzuf2 first appeared in SCOPe 2.06
  
• d4xzuf2 appears in SCOPe 2.07