Lineage for d4xzub2 (4xzu B:110-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 2354438Domain d4xzub2: 4xzu B:110-213 [301386]
    Other proteins in same PDB: d4xzub1, d4xzuf1, d4xzug_, d4xzum_
    automated match to d4ebql2
    complexed with mg

Details for d4xzub2

PDB Entry: 4xzu (more details), 2.61 Å

PDB Description: crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
PDB Compounds: (B:) 3E6 antibody Fab light chain

SCOPe Domain Sequences for d4xzub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzub2 b.1.1.2 (B:110-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathststspivksfnrnec

SCOPe Domain Coordinates for d4xzub2:

Click to download the PDB-style file with coordinates for d4xzub2.
(The format of our PDB-style files is described here.)

Timeline for d4xzub2: