Lineage for d4xzub1 (4xzu B:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761031Domain d4xzub1: 4xzu B:1-109 [301385]
    Other proteins in same PDB: d4xzua_, d4xzub2, d4xzue_, d4xzuf2, d4xzug_, d4xzum_
    automated match to d4ebql1
    complexed with mg

Details for d4xzub1

PDB Entry: 4xzu (more details), 2.61 Å

PDB Description: crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
PDB Compounds: (B:) 3E6 antibody Fab light chain

SCOPe Domain Sequences for d4xzub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzub1 b.1.1.0 (B:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkrad

SCOPe Domain Coordinates for d4xzub1:

Click to download the PDB-style file with coordinates for d4xzub1.
(The format of our PDB-style files is described here.)

Timeline for d4xzub1: