Lineage for d7mdhd1 (7mdh D:21-197)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) 
Protein Malate dehydrogenase [51849] (13 species) 
Species Sorghum (Sorghum vulgare), chloroplast [TaxId:4558] [51851] (1 PDB entry) 
Domain d7mdhd1: 7mdh D:21-197 [30133]
Other proteins in same PDB: d7mdha2, d7mdhb2, d7mdhc2, d7mdhd2
complexed with zn
Details for d7mdhd1
PDB Entry: 7mdh (more details), 2.4 Å
PDB Description: structural basis for light acitvation of a chloroplast enzyme. the structure of sorghum nadp-malate dehydrogenase in its oxidized form
PDB Compounds: (D:) protein (malate dehydrogenase)SCOPe Domain Sequences for d7mdhd1:
Sequence, based on SEQRES records: (download)
>d7mdhd1 c.2.1.5 (D:21-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]}
rkdcfgvfcttydlkaedktkswkklvniavsgaagmisnhllfklasgevfgqdqpial
kllgsersfqalegvameledslypllrevsigidpyevfedvdwalligakprgpgmer
aalldingqifadqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal
Sequence, based on observed residues (ATOM records): (download)
>d7mdhd1 c.2.1.5 (D:21-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]}
rkdcfgvfcttydwkklvniavsgaagmisnhllfklasgevfgqdqpialkllgsersf
qalegvameledslypllrevsigidpyevfedvdwalligakprgpgmeraalldingq
ifadqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal
SCOPe Domain Coordinates for d7mdhd1:
Click to download the PDB-style file with coordinates for d7mdhd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7mdhd1:
View in 3D
