Lineage for d7mdhc1 (7mdh C:23-197)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388323Protein Malate dehydrogenase [51849] (11 species)
  7. 388380Species Sorghum (Sorghum vulgare), chloroplast [TaxId:4558] [51851] (1 PDB entry)
  8. 388383Domain d7mdhc1: 7mdh C:23-197 [30132]
    Other proteins in same PDB: d7mdha2, d7mdhb2, d7mdhc2, d7mdhd2

Details for d7mdhc1

PDB Entry: 7mdh (more details), 2.4 Å

PDB Description: structural basis for light acitvation of a chloroplast enzyme. the structure of sorghum nadp-malate dehydrogenase in its oxidized form

SCOP Domain Sequences for d7mdhc1:

Sequence, based on SEQRES records: (download)

>d7mdhc1 c.2.1.5 (C:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast}
dcfgvfcttydlkaedktkswkklvniavsgaagmisnhllfklasgevfgqdqpialkl
lgsersfqalegvameledslypllrevsigidpyevfedvdwalligakprgpgmeraa
lldingqifadqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal

Sequence, based on observed residues (ATOM records): (download)

>d7mdhc1 c.2.1.5 (C:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast}
dcfgvfcttswkklvniavsgaagmisnhllfklasgevfgqdqpialkllgsersfqal
egvameledslypllrevsigidpyevfedvdwalligakprgpgmeraalldingqifa
dqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal

SCOP Domain Coordinates for d7mdhc1:

Click to download the PDB-style file with coordinates for d7mdhc1.
(The format of our PDB-style files is described here.)

Timeline for d7mdhc1: