Lineage for d4mdhb1 (4mdh B:1-154)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579257Protein Malate dehydrogenase [51849] (13 species)
  7. 1579321Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 1579329Domain d4mdhb1: 4mdh B:1-154 [30129]
    Other proteins in same PDB: d4mdha2, d4mdhb2
    complexed with nad, so4

Details for d4mdhb1

PDB Entry: 4mdh (more details), 2.5 Å

PDB Description: refined crystal structure of cytoplasmic malate dehydrogenase at 2.5- angstroms resolution
PDB Compounds: (B:) cytoplasmic malate dehydrogenase

SCOPe Domain Sequences for d4mdhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mdhb1 c.2.1.5 (B:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl

SCOPe Domain Coordinates for d4mdhb1:

Click to download the PDB-style file with coordinates for d4mdhb1.
(The format of our PDB-style files is described here.)

Timeline for d4mdhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mdhb2