Lineage for d4x4ya_ (4x4y A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356892Domain d4x4ya_: 4x4y A: [301269]
    Other proteins in same PDB: d4x4yb_, d4x4yd_
    automated match to d2q20b_
    mutant

Details for d4x4ya_

PDB Entry: 4x4y (more details), 2.49 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin scfv mutant k30d/s52d.
PDB Compounds: (A:) Human Variable Heavy Chain of Herceptin

SCOPe Domain Sequences for d4x4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x4ya_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfniddtyihwvrqapgkglewvariyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs

SCOPe Domain Coordinates for d4x4ya_:

Click to download the PDB-style file with coordinates for d4x4ya_.
(The format of our PDB-style files is described here.)

Timeline for d4x4ya_: