SCOPe 2.08: Domain d4x4xc_: 4x4x C:

Lineage for d4x4xc_ (4x4x C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4x4xc_: 4x4x C: [301268]
   Other proteins in same PDB: d4x4xb_, d4x4xd_
   automated match to d2q20b_
   mutant

Details for d4x4xc_

PDB Entry: 4x4x, 2.25 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin scfv mutant.

PDB Compounds: (C:) Human Variable Heavy Chain of Herceptin

SCOPe Domain Sequences for d4x4xc_:

Sequence, based on SEQRES records:

>d4x4xc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs

Sequence, based on observed residues (ATOM records):

>d4x4xc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycsrwamdvwgqgtlvtvs

Timeline for d4x4xc_:

• d4x4xc_ first appeared in SCOPe 2.06
  
• d4x4xc_ appears in SCOPe 2.07