Lineage for d4wwif1 (4wwi F:238-341)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757139Domain d4wwif1: 4wwi F:238-341 [301231]
    Other proteins in same PDB: d4wwia_, d4wwib_, d4wwic_
    automated match to d4hafa1

Details for d4wwif1

PDB Entry: 4wwi (more details), 2.31 Å

PDB Description: crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
PDB Compounds: (F:) Ig gamma-3 chain C region

SCOPe Domain Sequences for d4wwif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwif1 b.1.1.0 (F:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkg

SCOPe Domain Coordinates for d4wwif1:

Click to download the PDB-style file with coordinates for d4wwif1.
(The format of our PDB-style files is described here.)

Timeline for d4wwif1: