Lineage for d1mldb1 (1mld B:1-144)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105845Protein Malate dehydrogenase [51849] (13 species)
  7. 2105913Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 2105915Domain d1mldb1: 1mld B:1-144 [30123]
    Other proteins in same PDB: d1mlda2, d1mldb2, d1mldc2, d1mldd2
    complexed with cit

Details for d1mldb1

PDB Entry: 1mld (more details), 1.83 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1mldb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mldb1 c.2.1.5 (B:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
nstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d1mldb1:

Click to download the PDB-style file with coordinates for d1mldb1.
(The format of our PDB-style files is described here.)

Timeline for d1mldb1: