Lineage for d1d4gh1 (1d4g H:190-352)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20482Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (8 proteins)
  6. 20513Protein S-adenosylhomocystein hydrolase [51845] (2 species)
  7. 20517Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (3 PDB entries)
  8. 20533Domain d1d4gh1: 1d4g H:190-352 [30121]
    Other proteins in same PDB: d1d4ga2, d1d4gb2, d1d4gc2, d1d4gd2, d1d4ge2, d1d4gf2, d1d4gg2, d1d4gh2

Details for d1d4gh1

PDB Entry: 1d4g (more details), 3 Å

PDB Description: crystal structure of s-adenosylhomocysteine hydrolase (adohcyase) complexed with a potent inhibitor d-eritadenine

SCOP Domain Sequences for d1d4gh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4gh1 c.2.1.4 (H:190-352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllkngrriillaegrlvnlgcamgh

SCOP Domain Coordinates for d1d4gh1:

Click to download the PDB-style file with coordinates for d1d4gh1.
(The format of our PDB-style files is described here.)

Timeline for d1d4gh1: