SCOP 1.71: Domain d1d4gc1: 1d4g C:190-352

Lineage for d1d4gc1 (1d4g C:190-352)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein S-adenosylhomocystein hydrolase [51845] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (6 PDB entries)

8. Domain d1d4gc1: 1d4g C:190-352 [30116]
   Other proteins in same PDB: d1d4ga2, d1d4gb2, d1d4gc2, d1d4gd2, d1d4ge2, d1d4gf2, d1d4gg2, d1d4gh2

Details for d1d4gc1

PDB Entry: 1d4g, 3 Å

PDB Description: crystal structure of s-adenosylhomocysteine hydrolase (adohcyase) complexed with a potent inhibitor d-eritadenine

SCOP Domain Sequences for d1d4gc1:

Sequence; same for both SEQRES and ATOM records:

>d1d4gc1 c.2.1.4 (C:190-352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllkngrriillaegrlvnlgcamgh

Timeline for d1d4gc1:

• d1d4gc1 first appeared (with stable ids) in SCOP 1.55
  
• d1d4gc1 appears in SCOP 1.69
  
• d1d4gc1 does not appear in SCOP 1.73