Lineage for d1d4fb1 (1d4f B:190-352)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844257Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 2844264Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)
  8. 2844298Domain d1d4fb1: 1d4f B:190-352 [30111]
    Other proteins in same PDB: d1d4fa2, d1d4fb2, d1d4fc2, d1d4fd2
    complexed with adn, nad; mutant

Details for d1d4fb1

PDB Entry: 1d4f (more details), 2.8 Å

PDB Description: crystal structure of recombinant rat-liver d244e mutant s- adenosylhomocysteine hydrolase
PDB Compounds: (B:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1d4fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4fb1 c.2.1.4 (B:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteiepinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOPe Domain Coordinates for d1d4fb1:

Click to download the PDB-style file with coordinates for d1d4fb1.
(The format of our PDB-style files is described here.)

Timeline for d1d4fb1: