SCOPe 2.08: Domain d4w9pe1: 4w9p E:16-139

Lineage for d4w9pe1 (4w9p E:16-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)

8. Domain d4w9pe1: 4w9p E:16-139 [301106]
   Other proteins in same PDB: d4w9pe2
   automated match to d3o5qa_
   complexed with 3jr, act

Details for d4w9pe1

PDB Entry: 4w9p, 1.5 Å

PDB Description: The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1S)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one

PDB Compounds: (E:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4w9pe1:

Sequence; same for both SEQRES and ATOM records:

>d4w9pe1 d.26.1.1 (E:16-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkg

Timeline for d4w9pe1:

• d4w9pe1 first appeared in SCOPe 2.06
  
• d4w9pe1 appears in SCOPe 2.07