SCOPe 2.08: Domain d1a7ab1: 1a7a B:190-352

Lineage for d1a7ab1 (1a7a B:190-352)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein S-adenosylhomocystein hydrolase [51845] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51846] (3 PDB entries)

8. Domain d1a7ab1: 1a7a B:190-352 [30105]
   Other proteins in same PDB: d1a7aa2, d1a7ab2
   complexed with adc, nad

Details for d1a7ab1

PDB Entry: 1a7a, 2.8 Å

PDB Description: structure of human placental s-adenosylhomocysteine hydrolase: determination of a 30 selenium atom substructure from data at a single wavelength

PDB Compounds: (B:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1a7ab1:

Sequence; same for both SEQRES and ATOM records:

>d1a7ab1 c.2.1.4 (B:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}
dnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpina
lqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdveidvk
wlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamg

Timeline for d1a7ab1:

• d1a7ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1a7ab1 appears in SCOPe 2.07