| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
Superfamily d.7.1: LysM domain [54106] (2 families) ![]() automatically mapped to Pfam PF01476 |
| Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
| Protein automated matches [234001] (7 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries) |
| Domain d4uz3b1: 4uz3 B:17-62 [301046] automated match to d4uz3c_ complexed with dio, ndg, so4 |
PDB Entry: 4uz3 (more details), 1.75 Å
SCOPe Domain Sequences for d4uz3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uz3b1 d.7.1.0 (B:17-62) automated matches {Thermus thermophilus [TaxId: 300852]}
atytvapgdtlysiarrygttveelmrlnglesfllqpgqvlklps
Timeline for d4uz3b1: