SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4uz3a2 (4uz3 A:63-114)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156385Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2156386Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2156395Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2156396Protein automated matches [234001] (3 species)
    not a true protein
  7. 2156412Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries)
  8. 2156414Domain d4uz3a2: 4uz3 A:63-114 [301045]
    automated match to d4uz3c_
    complexed with dio, so4

Details for d4uz3a2

PDB Entry: 4uz3 (more details), 1.75 Å

PDB Description: crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose
PDB Compounds: (A:) cell wall-binding endopeptidase-related protein

SCOPe Domain Sequences for d4uz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uz3a2 d.7.1.0 (A:63-114) automated matches {Thermus thermophilus [TaxId: 300852]}
rerthvvapgdtlfslarrygttvealmrlnglsspeikvgqvlrlpeegea

SCOPe Domain Coordinates for d4uz3a2:

Click to download the PDB-style file with coordinates for d4uz3a2.
(The format of our PDB-style files is described here.)

Timeline for d4uz3a2:

  • d4uz3a2 is new in SCOPe 2.06-stable