Class a: All alpha proteins [46456] (289 folds) |
Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) |
Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
Protein automated matches [190928] (7 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (6 PDB entries) |
Domain d4uypd_: 4uyp D: [301041] Other proteins in same PDB: d4uypa1, d4uypa2, d4uypa3, d4uypc1, d4uypc2, d4uypc3 automated match to d4uyqb_ complexed with ca, epe, mpd, so4; mutant |
PDB Entry: 4uyp (more details), 1.49 Å
SCOPe Domain Sequences for d4uypd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uypd_ a.139.1.0 (D:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} kfiygdvdgngsvrsidavlirdyvlgkinefpyeygmlaadvdgngsikindavlvrdy vlgkiflfpveek
Timeline for d4uypd_: