Lineage for d4uypb_ (4uyp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016921Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2016922Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2016940Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2016941Protein automated matches [190928] (7 species)
    not a true protein
  7. 2016942Species Acetivibrio cellulolyticus [TaxId:35830] [271532] (4 PDB entries)
  8. 2016943Domain d4uypb_: 4uyp B: [301038]
    Other proteins in same PDB: d4uypa1, d4uypa2, d4uypa3, d4uypc1, d4uypc2, d4uypc3
    automated match to d4uyqb_
    complexed with ca, epe, mpd, so4; mutant

Details for d4uypb_

PDB Entry: 4uyp (more details), 1.49 Å

PDB Description: high resolution structure of the third cohesin scac in complex with the scab dockerin with a mutation in the n-terminal helix (in to si) from acetivibrio cellulolyticus displaying a type i interaction.
PDB Compounds: (B:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d4uypb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uypb_ a.139.1.0 (B:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
kfiygdvdgngsvrsidavlirdyvlgkinefpyeygmlaadvdgngsikindavlvrdy
vlgkiflfpveek

SCOPe Domain Coordinates for d4uypb_:

Click to download the PDB-style file with coordinates for d4uypb_.
(The format of our PDB-style files is described here.)

Timeline for d4uypb_: