Lineage for d1pjba1 (1pjb A:136-303)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821313Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 821337Protein L-alanine dehydrogenase [51843] (1 species)
  7. 821338Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries)
  8. 821341Domain d1pjba1: 1pjb A:136-303 [30103]
    Other proteins in same PDB: d1pjba2

Details for d1pjba1

PDB Entry: 1pjb (more details), 2.1 Å

PDB Description: l-alanine dehydrogenase
PDB Compounds: (A:) l-alanine dehydrogenase

SCOP Domain Sequences for d1pjba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjba1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi
fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve
qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga

SCOP Domain Coordinates for d1pjba1:

Click to download the PDB-style file with coordinates for d1pjba1.
(The format of our PDB-style files is described here.)

Timeline for d1pjba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pjba2