Lineage for d1pjca1 (1pjc A:136-303)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105396Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2105420Protein L-alanine dehydrogenase [51843] (1 species)
  7. 2105421Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries)
  8. 2105422Domain d1pjca1: 1pjc A:136-303 [30101]
    Other proteins in same PDB: d1pjca2
    complexed with nad

Details for d1pjca1

PDB Entry: 1pjc (more details), 2 Å

PDB Description: l-alanine dehydrogenase complexed with nad
PDB Compounds: (A:) protein (l-alanine dehydrogenase)

SCOPe Domain Sequences for d1pjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi
fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve
qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga

SCOPe Domain Coordinates for d1pjca1:

Click to download the PDB-style file with coordinates for d1pjca1.
(The format of our PDB-style files is described here.)

Timeline for d1pjca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pjca2