| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
| Protein L-alanine dehydrogenase [51843] (1 species) |
| Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries) |
| Domain d1pjca1: 1pjc A:136-303 [30101] Other proteins in same PDB: d1pjca2 complexed with nad |
PDB Entry: 1pjc (more details), 2 Å
SCOPe Domain Sequences for d1pjca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi
fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve
qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga
Timeline for d1pjca1: