| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
| Protein D-lactate dehydrogenase [51841] (1 species) |
| Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries) |
| Domain d2dldb1: 2dld B:104-300 [30100] Other proteins in same PDB: d2dlda2, d2dldb2 complexed with nai, oxm |
PDB Entry: 2dld (more details), 2.7 Å
SCOPe Domain Sequences for d2dldb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dldb1 c.2.1.4 (B:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
pnaiaehaaiqaarvlrqdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmr
imegfgakviaydifknpelekkgyyvdslddlykqadvislhvpdvpanvhmindksia
emkdgvvivncsrgrlvdtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrl
adlidrpnvlvtphtaf
Timeline for d2dldb1: