Lineage for d2dlda1 (2dld A:104-300)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66721Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (9 proteins)
  6. 66729Protein D-lactate dehydrogenase [51841] (1 species)
  7. 66730Species Lactobacillus helveticus [TaxId:1587] [51842] (1 PDB entry)
  8. 66731Domain d2dlda1: 2dld A:104-300 [30099]
    Other proteins in same PDB: d2dlda2, d2dldb2

Details for d2dlda1

PDB Entry: 2dld (more details), 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d2dlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlda1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus}
pnaiaehaaiqaarvlrqdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmr
imegfgakviaydifknpelekkgyyvdslddlykqadvislhvpdvpanvhmindksia
emkdgvvivncsrgrlvdtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrl
adlidrpnvlvtphtaf

SCOP Domain Coordinates for d2dlda1:

Click to download the PDB-style file with coordinates for d2dlda1.
(The format of our PDB-style files is described here.)

Timeline for d2dlda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlda2