Lineage for d1psdb1 (1psd B:108-295)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238994Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 239039Protein Phosphoglycerate dehydrogenase [51839] (1 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 239040Species Escherichia coli [TaxId:562] [51840] (1 PDB entry)
  8. 239042Domain d1psdb1: 1psd B:108-295 [30098]
    Other proteins in same PDB: d1psda2, d1psda3, d1psdb2, d1psdb3
    complexed with nad

Details for d1psdb1

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1psdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psdb1 c.2.1.4 (B:108-295) Phosphoglycerate dehydrogenase {Escherichia coli}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipalcdalaskhlagaaidvfptepatnsdpftsplcefdnv
lltphigg

SCOP Domain Coordinates for d1psdb1:

Click to download the PDB-style file with coordinates for d1psdb1.
(The format of our PDB-style files is described here.)

Timeline for d1psdb1: