SCOPe 2.05: Domain d1gdhb1: 1gdh B:101-291

Lineage for d1gdhb1 (1gdh B:101-291)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein D-glycerate dehydrogenase [51837] (1 species)

7. Species Hyphomicrobium methylovorum [TaxId:84] [51838] (1 PDB entry)

8. Domain d1gdhb1: 1gdh B:101-291 [30096]
   Other proteins in same PDB: d1gdha2, d1gdhb2
   complexed with so4

Details for d1gdhb1

PDB Entry: 1gdh, 2.4 Å

PDB Description: crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution

PDB Compounds: (B:) d-glycerate dehydrogenase

SCOPe Domain Sequences for d1gdhb1:

Sequence; same for both SEQRES and ATOM records:

>d1gdhb1 c.2.1.4 (B:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]}
vtvataeiamllllgsarragegekmirtrswpgweplelvgekldnktlgiygfgsigq
alakraqgfdmdidyfdthrasssdeasyqatfhdsldsllsvsqffslnapstpetryf
fnkatikslpqgaivvntargdlvdnelvvaaleagrlayagfdvfagepninegyydlp
ntflfphigsa

Timeline for d1gdhb1:

• d1gdhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gdhb1 appears in SCOPe 2.04
  
• d1gdhb1 appears in SCOPe 2.06
  
• d1gdhb1 appears in the current release, SCOPe 2.08