Lineage for d1gdha1 (1gdh A:101-291)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308776Protein D-glycerate dehydrogenase [51837] (1 species)
  7. 308777Species Hyphomicrobium methylovorum [TaxId:84] [51838] (1 PDB entry)
  8. 308778Domain d1gdha1: 1gdh A:101-291 [30095]
    Other proteins in same PDB: d1gdha2, d1gdhb2

Details for d1gdha1

PDB Entry: 1gdh (more details), 2.4 Å

PDB Description: crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution

SCOP Domain Sequences for d1gdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum}
vtvataeiamllllgsarragegekmirtrswpgweplelvgekldnktlgiygfgsigq
alakraqgfdmdidyfdthrasssdeasyqatfhdsldsllsvsqffslnapstpetryf
fnkatikslpqgaivvntargdlvdnelvvaaleagrlayagfdvfagepninegyydlp
ntflfphigsa

SCOP Domain Coordinates for d1gdha1:

Click to download the PDB-style file with coordinates for d1gdha1.
(The format of our PDB-style files is described here.)

Timeline for d1gdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gdha2