Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein D-glycerate dehydrogenase [51837] (1 species) |
Species Hyphomicrobium methylovorum [TaxId:84] [51838] (1 PDB entry) |
Domain d1gdha1: 1gdh A:101-291 [30095] Other proteins in same PDB: d1gdha2, d1gdhb2 |
PDB Entry: 1gdh (more details), 2.4 Å
SCOP Domain Sequences for d1gdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum} vtvataeiamllllgsarragegekmirtrswpgweplelvgekldnktlgiygfgsigq alakraqgfdmdidyfdthrasssdeasyqatfhdsldsllsvsqffslnapstpetryf fnkatikslpqgaivvntargdlvdnelvvaaleagrlayagfdvfagepninegyydlp ntflfphigsa
Timeline for d1gdha1: