Lineage for d1qp8b1 (1qp8 B:83-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844253Protein Putative formate dehydrogenase [51833] (1 species)
  7. 2844254Species Pyrobaculum aerophilum [TaxId:13773] [51834] (1 PDB entry)
  8. 2844256Domain d1qp8b1: 1qp8 B:83-263 [30093]
    Other proteins in same PDB: d1qp8a2, d1qp8b2
    complexed with ndp

Details for d1qp8b1

PDB Entry: 1qp8 (more details), 2.8 Å

PDB Description: crystal structure of a putative formate dehydrogenase from pyrobaculum aerophilum
PDB Compounds: (B:) formate dehydrogenase

SCOPe Domain Sequences for d1qp8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp8b1 c.2.1.4 (B:83-263) Putative formate dehydrogenase {Pyrobaculum aerophilum [TaxId: 13773]}
adavaefalalllapykriiqygekmkrgdygrdveipliqgekvavlglgeigtrvgki
laalgaqvrgfsrtpkegpwrftnsleealrearaavcalplnkhtrglvkyqhlalmae
davfvnvgraevldrdgvlrilkerpqfifasdvwwgrndfakdaeffslpnvvatpwva
g

SCOPe Domain Coordinates for d1qp8b1:

Click to download the PDB-style file with coordinates for d1qp8b1.
(The format of our PDB-style files is described here.)

Timeline for d1qp8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qp8b2