SCOPe 2.07: Domain d4ubua2: 4ubu A:269-391

Lineage for d4ubua2 (4ubu A:269-391)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (17 PDB entries)

8. Domain d4ubua2: 4ubu A:269-391 [300919]
   Other proteins in same PDB: d4ubue3, d4ubug3, d4ubuh3
   automated match to d4wysa2
   complexed with coa, gol

Details for d4ubua2

PDB Entry: 4ubu, 3 Å

PDB Description: structure of a modified c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with coa

PDB Compounds: (A:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubua2:

Sequence; same for both SEQRES and ATOM records:

>d4ubua2 c.95.1.0 (A:269-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarv
hepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtii
eri

Timeline for d4ubua2:

• d4ubua2 first appeared in SCOPe 2.06
  
• d4ubua2 appears in the current release, SCOPe 2.08