Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Formate dehydrogenase [51831] (1 species) |
Species Pseudomonas sp., strain 101 [TaxId:306] [51832] (2 PDB entries) |
Domain d2nacb1: 2nac B:148-335 [30089] Other proteins in same PDB: d2naca2, d2nacb2 complexed with so4 |
PDB Entry: 2nac (more details), 1.8 Å
SCOPe Domain Sequences for d2nacb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nacb1 c.2.1.4 (B:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} isvaehvvmmilslvrnylpshewarkggwniadcvshaydleamhvgtvaagriglavl rrlapfdvhlhytdrhrlpesvekelnltwhatredmypvcdvvtlncplhpetehmind etlklfkrgayivntargklcdrdavaralesgrlagyagdvwfpqpapkdhpwrtmpyn gmtphisg
Timeline for d2nacb1: