Lineage for d2nacb1 (2nac B:148-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844174Protein Formate dehydrogenase [51831] (1 species)
  7. 2844175Species Pseudomonas sp., strain 101 [TaxId:306] [51832] (2 PDB entries)
  8. 2844177Domain d2nacb1: 2nac B:148-335 [30089]
    Other proteins in same PDB: d2naca2, d2nacb2
    complexed with so4

Details for d2nacb1

PDB Entry: 2nac (more details), 1.8 Å

PDB Description: high resolution structures of holo and apo formate dehydrogenase
PDB Compounds: (B:) nad-dependent formate dehydrogenase

SCOPe Domain Sequences for d2nacb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nacb1 c.2.1.4 (B:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]}
isvaehvvmmilslvrnylpshewarkggwniadcvshaydleamhvgtvaagriglavl
rrlapfdvhlhytdrhrlpesvekelnltwhatredmypvcdvvtlncplhpetehmind
etlklfkrgayivntargklcdrdavaralesgrlagyagdvwfpqpapkdhpwrtmpyn
gmtphisg

SCOPe Domain Coordinates for d2nacb1:

Click to download the PDB-style file with coordinates for d2nacb1.
(The format of our PDB-style files is described here.)

Timeline for d2nacb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nacb2