Lineage for d1qkih1 (1qki H:10-199,H:435-449)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66575Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 66576Species Human (Homo sapiens) [TaxId:9606] [51829] (1 PDB entry)
  8. 66584Domain d1qkih1: 1qki H:10-199,H:435-449 [30087]
    Other proteins in same PDB: d1qkia2, d1qkib2, d1qkic2, d1qkid2, d1qkie2, d1qkif2, d1qkig2, d1qkih2

Details for d1qkih1

PDB Entry: 1qki (more details), 3 Å

PDB Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+

SCOP Domain Sequences for d1qkih1:

Sequence, based on SEQRES records: (download)

>d1qkih1 c.2.1.3 (H:10-199,H:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens)}
thvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivg
yarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalh
lgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhiss
lfredqiyriXdayerlildvfcgsq

Sequence, based on observed residues (ATOM records): (download)

>d1qkih1 c.2.1.3 (H:10-199,H:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens)}
thvcgqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyriXda
yerlildvfcgsq

SCOP Domain Coordinates for d1qkih1:

Click to download the PDB-style file with coordinates for d1qkih1.
(The format of our PDB-style files is described here.)

Timeline for d1qkih1: