Lineage for d4tv9f2 (4tv9 F:77-378)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217619Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2217620Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2217621Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries)
  8. 2217625Domain d4tv9f2: 4tv9 F:77-378 [300844]
    Other proteins in same PDB: d4tv9a1, d4tv9a2, d4tv9b1, d4tv9b2, d4tv9c1, d4tv9c2, d4tv9d1, d4tv9d2, d4tv9e_, d4tv9f1
    automated match to d3tiia2
    complexed with 3h4, acp, ca, gdp, gol, gtp, mes, mg

Details for d4tv9f2

PDB Entry: 4tv9 (more details), 2 Å

PDB Description: Tubulin-PM060184 complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d4tv9f2:

Sequence, based on SEQRES records: (download)

>d4tv9f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4tv9f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnltderevflaaynrgnvwiakssegilissea
selldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtsse
pynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlensillq
ikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyael
cqgivdvaissvfplasifikl

SCOPe Domain Coordinates for d4tv9f2:

Click to download the PDB-style file with coordinates for d4tv9f2.
(The format of our PDB-style files is described here.)

Timeline for d4tv9f2: