Lineage for d4tuyf2 (4tuy F:77-378)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217619Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2217620Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2217621Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries)
  8. 2217627Domain d4tuyf2: 4tuy F:77-378 [300839]
    Other proteins in same PDB: d4tuya1, d4tuya2, d4tuyb1, d4tuyb2, d4tuyc1, d4tuyc2, d4tuyd1, d4tuyd2, d4tuye_, d4tuyf1
    automated match to d3tiia2
    complexed with 36l, acp, ca, gdp, gtp, mes, mg

Details for d4tuyf2

PDB Entry: 4tuy (more details), 2.1 Å

PDB Description: Tubulin-Rhizoxin complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4tuyf2:

Sequence, based on SEQRES records: (download)

>d4tuyf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4tuyf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiaksgilisse
aselldfidvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn
sanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlensillqikh
iirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqg
ivdvaissvfplasifikl

SCOPe Domain Coordinates for d4tuyf2:

Click to download the PDB-style file with coordinates for d4tuyf2.
(The format of our PDB-style files is described here.)

Timeline for d4tuyf2: