Lineage for d4to8b1 (4to8 B:2-286)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086888Species Staphylococcus aureus [TaxId:1280] [261289] (1 PDB entry)
  8. 2086890Domain d4to8b1: 4to8 B:2-286 [300800]
    Other proteins in same PDB: d4to8a2, d4to8b2
    automated match to d4to8a_
    complexed with flc, zn

Details for d4to8b1

PDB Entry: 4to8 (more details), 2.1 Å

PDB Description: methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase
PDB Compounds: (B:) Fructose-1,6-bisphosphate aldolase, class II

SCOPe Domain Sequences for d4to8b1:

Sequence, based on SEQRES records: (download)

>d4to8b1 c.1.10.0 (B:2-286) automated matches {Staphylococcus aureus [TaxId: 1280]}
plvsmkemlidakengyavgqyninnleftqaileasqeenapvilgvsegaarymsgfy
tivkmveglmhdlnitipvaihldhgssfekckeaidagftsvmidashspfeenvattk
kvveyahekgvsveaelgtvggqeddvvadgiiyadpkecqelvektgidalapalgsvh
gpykgepklgfkemeeiglstglplvlhggtgiptkdiqkaipfgtakinvntenqiasa
kavrdvlnndkevydprkylgpareaiketvkgkikefgtsnrak

Sequence, based on observed residues (ATOM records): (download)

>d4to8b1 c.1.10.0 (B:2-286) automated matches {Staphylococcus aureus [TaxId: 1280]}
plvsmkemlidakengyavgqyninnleftqaileasqeenapvilgvsegaarymsgfy
tivkmveglmhdlnitipvaihldhgssfekckeaidagftsvmidashspfeenvattk
kvveyahekgvsveaelgtvggddvvadgiiyadpkecqelvektgidalapalgsvhpk
lgfkemeeiglstglplvlhggtgiptkdiqkaipfgtakinvntenqiasakavrdvln
ndkevydprkylgpareaiketvkgkikefgtsnrak

SCOPe Domain Coordinates for d4to8b1:

Click to download the PDB-style file with coordinates for d4to8b1.
(The format of our PDB-style files is described here.)

Timeline for d4to8b1:

  • d4to8b1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4to8b2