Lineage for d1e7ma1 (1e7m A:1-181,A:413-426)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20340Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 20350Species Leuconostoc mesenteroides [TaxId:1245] [51828] (5 PDB entries)
  8. 20356Domain d1e7ma1: 1e7m A:1-181,A:413-426 [30079]
    Other proteins in same PDB: d1e7ma2

Details for d1e7ma1

PDB Entry: 1e7m (more details), 2.54 Å

PDB Description: active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides

SCOP Domain Sequences for d1e7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ma1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfrinhyl
gXepyermihdtmngd

SCOP Domain Coordinates for d1e7ma1:

Click to download the PDB-style file with coordinates for d1e7ma1.
(The format of our PDB-style files is described here.)

Timeline for d1e7ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e7ma2