Lineage for d1dpgb1 (1dpg B:1-181,B:413-426)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452075Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 2452085Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)
  8. 2452088Domain d1dpgb1: 1dpg B:1-181,B:413-426 [30075]
    Other proteins in same PDB: d1dpga2, d1dpgb2
    complexed with po4

Details for d1dpgb1

PDB Entry: 1dpg (more details), 2 Å

PDB Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
PDB Compounds: (B:) glucose 6-phosphate dehydrogenase

SCOPe Domain Sequences for d1dpgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpgb1 c.2.1.3 (B:1-181,B:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
cikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

SCOPe Domain Coordinates for d1dpgb1:

Click to download the PDB-style file with coordinates for d1dpgb1.
(The format of our PDB-style files is described here.)

Timeline for d1dpgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpgb2