SCOPe 2.04: Domain d1dpgb1: 1dpg B:1-181,B:413-426

Lineage for d1dpgb1 (1dpg B:1-181,B:413-426)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)

7. Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)

8. Domain d1dpgb1: 1dpg B:1-181,B:413-426 [30075]
   Other proteins in same PDB: d1dpga2, d1dpgb2
   complexed with po4

Details for d1dpgb1

PDB Entry: 1dpg, 2 Å

PDB Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides

PDB Compounds: (B:) glucose 6-phosphate dehydrogenase

SCOPe Domain Sequences for d1dpgb1:

Sequence; same for both SEQRES and ATOM records:

>d1dpgb1 c.2.1.3 (B:1-181,B:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
cikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

Timeline for d1dpgb1:

• d1dpgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dpgb1 appears in SCOPe 2.03
  
• d1dpgb1 appears in SCOPe 2.05
  
• d1dpgb1 appears in the current release, SCOPe 2.08