Lineage for d1dpga1 (1dpg A:1-181,A:413-426)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 477857Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 477867Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)
  8. 477868Domain d1dpga1: 1dpg A:1-181,A:413-426 [30074]
    Other proteins in same PDB: d1dpga2, d1dpgb2

Details for d1dpga1

PDB Entry: 1dpg (more details), 2 Å

PDB Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides

SCOP Domain Sequences for d1dpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpga1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
cikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

SCOP Domain Coordinates for d1dpga1:

Click to download the PDB-style file with coordinates for d1dpga1.
(The format of our PDB-style files is described here.)

Timeline for d1dpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpga2