Lineage for d1evjb1 (1evj B:30-160,B:323-381)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 976724Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 976892Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 976893Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)
  8. 976925Domain d1evjb1: 1evj B:30-160,B:323-381 [30071]
    Other proteins in same PDB: d1evja2, d1evjb2, d1evjc2, d1evjd2
    complexed with nad

Details for d1evjb1

PDB Entry: 1evj (more details), 2.7 Å

PDB Description: crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
PDB Compounds: (B:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1evjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evjb1 c.2.1.3 (B:30-160,B:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
kklmigyrchyXnqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn
tdwgyvrqggy

SCOPe Domain Coordinates for d1evjb1:

Click to download the PDB-style file with coordinates for d1evjb1.
(The format of our PDB-style files is described here.)

Timeline for d1evjb1: