Lineage for d1evja1 (1evj A:30-160,A:323-381)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 820928Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 820929Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)
  8. 820954Domain d1evja1: 1evj A:30-160,A:323-381 [30070]
    Other proteins in same PDB: d1evja2, d1evjb2, d1evjc2, d1evjd2

Details for d1evja1

PDB Entry: 1evj (more details), 2.7 Å

PDB Description: crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
PDB Compounds: (A:) glucose-fructose oxidoreductase

SCOP Domain Sequences for d1evja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evja1 c.2.1.3 (A:30-160,A:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
kklmigyrchyXnqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn
tdwgyvrqggy

SCOP Domain Coordinates for d1evja1:

Click to download the PDB-style file with coordinates for d1evja1.
(The format of our PDB-style files is described here.)

Timeline for d1evja1: