SCOPe 2.05: Domain d1ofgd1: 1ofg D:1-160,D:323-381

Lineage for d1ofgd1 (1ofg D:1-160,D:323-381)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)

8. Domain d1ofgd1: 1ofg D:1-160,D:323-381 [30067]
   Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2
   complexed with ndp

Details for d1ofgd1

PDB Entry: 1ofg, 2.7 Å

PDB Description: glucose-fructose oxidoreductase

PDB Compounds: (D:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1ofgd1:

Sequence; same for both SEQRES and ATOM records:

>d1ofgd1 c.2.1.3 (D:1-160,D:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

Timeline for d1ofgd1:

• d1ofgd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ofgd1 appears in SCOPe 2.04
  
• d1ofgd1 appears in SCOPe 2.06
  
• d1ofgd1 appears in the current release, SCOPe 2.08