Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (9 PDB entries) |
Domain d4rkfb_: 4rkf B: [300667] automated match to d4uj5a_ complexed with 1pe, gnp, mg |
PDB Entry: 4rkf (more details), 1.5 Å
SCOPe Domain Sequences for d4rkfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rkfb_ c.37.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qnfdymfklliignssvgktsflfryaddsftsafvstvgidfkvktvfrhdkrvklqiw dtagleryrtittayyrgamgfilmydvtnedsfnsvqdwvtqiktyswdnaqvilvgnk cdmedqrvisfergrqladqlgveffetsakenvnvkavferlvdiicdkms
Timeline for d4rkfb_: