Lineage for d4rkfb_ (4rkf B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128518Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (9 PDB entries)
  8. 2128520Domain d4rkfb_: 4rkf B: [300667]
    automated match to d4uj5a_
    complexed with 1pe, gnp, mg

Details for d4rkfb_

PDB Entry: 4rkf (more details), 1.5 Å

PDB Description: Drosophila melanogaster Rab3 bound to GMPPNP
PDB Compounds: (B:) Ras-related protein Rab-3

SCOPe Domain Sequences for d4rkfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkfb_ c.37.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qnfdymfklliignssvgktsflfryaddsftsafvstvgidfkvktvfrhdkrvklqiw
dtagleryrtittayyrgamgfilmydvtnedsfnsvqdwvtqiktyswdnaqvilvgnk
cdmedqrvisfergrqladqlgveffetsakenvnvkavferlvdiicdkms

SCOPe Domain Coordinates for d4rkfb_:

Click to download the PDB-style file with coordinates for d4rkfb_.
(The format of our PDB-style files is described here.)

Timeline for d4rkfb_: