Lineage for d1ofgc1 (1ofg C:1-160,C:323-381)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins) 
Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) Species Zymomonas mobilis [TaxId:542] [51826] (2 PDB entries) 
Domain d1ofgc1: 1ofg C:1-160,C:323-381 [30066]
Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2
Details for d1ofgc1
PDB Entry: 1ofg (more details), 2.7 Å
PDB Description: glucose-fructose oxidoreductase
SCOP Domain Sequences for d1ofgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofgc1 c.2.1.3 (C:1-160,C:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
SCOP Domain Coordinates for d1ofgc1:
Click to download the PDB-style file with coordinates for d1ofgc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ofgc1:
View in 3D
