SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4rf0a1 (4rf0 A:1484-1542)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (19 species)
    not a true protein
  7. 2159578Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (3 PDB entries)
  8. 2159581Domain d4rf0a1: 4rf0 A:1484-1542 [300656]
    Other proteins in same PDB: d4rf0a2, d4rf0b_
    automated match to d4p16a1
    complexed with 3cn, so4, zn

Details for d4rf0a1

PDB Entry: 4rf0 (more details), 2.8 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P6522)
PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4rf0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rf0a1 d.15.1.0 (A:1484-1542) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
tievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

SCOPe Domain Coordinates for d4rf0a1:

Click to download the PDB-style file with coordinates for d4rf0a1.
(The format of our PDB-style files is described here.)

Timeline for d4rf0a1:

  • d4rf0a1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4rf0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4rf0b_