Lineage for d4rdql2 (4rdq L:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753251Domain d4rdql2: 4rdq L:108-212 [300647]
    Other proteins in same PDB: d4rdqf1, d4rdqg1, d4rdqg2, d4rdqh1, d4rdqi1, d4rdqi2, d4rdqj1, d4rdqk1, d4rdqk2, d4rdql1, d4rdqm1, d4rdqm2, d4rdqn1, d4rdqo1, d4rdqo2
    automated match to d2fd6l2
    complexed with c6n, ca, cl, gol, k

Details for d4rdql2

PDB Entry: 4rdq (more details), 2.85 Å

PDB Description: calcium-activated chloride channel bestrophin-1, from chicken, in complex with fab antibody fragments, chloride and calcium
PDB Compounds: (L:) Fab antibody fragment, light chain

SCOPe Domain Sequences for d4rdql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rdql2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4rdql2:

Click to download the PDB-style file with coordinates for d4rdql2.
(The format of our PDB-style files is described here.)

Timeline for d4rdql2: