SCOPe 2.08: Domain d4rdql2: 4rdq L:108-212

Lineage for d4rdql2 (4rdq L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4rdql2: 4rdq L:108-212 [300647]
   Other proteins in same PDB: d4rdqf1, d4rdqg1, d4rdqg2, d4rdqh1, d4rdqi1, d4rdqi2, d4rdqj1, d4rdqk1, d4rdqk2, d4rdql1, d4rdqm1, d4rdqm2, d4rdqn1, d4rdqo1, d4rdqo2
   automated match to d2fd6l2
   complexed with c6n, ca, cl, gol, k

Details for d4rdql2

PDB Entry: 4rdq, 2.85 Å

PDB Description: calcium-activated chloride channel bestrophin-1, from chicken, in complex with fab antibody fragments, chloride and calcium

PDB Compounds: (L:) Fab antibody fragment, light chain

SCOPe Domain Sequences for d4rdql2:

Sequence; same for both SEQRES and ATOM records:

>d4rdql2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4rdql2:

• d4rdql2 first appeared in SCOPe 2.06
  
• d4rdql2 appears in SCOPe 2.07